Everything below concerns albumin binding. We keep the language plain, cite what the science says, and separate well-supported claims from open questions.
Updated 2026-01-07. Numbers and descriptions here follow the published literature rather than marketing material.
The peptide backbone corresponds to GRF(1-29), the first 29 residues of native growth hormone-releasing hormone, which retains most of the receptor-activating activity of the full-length molecule. Four substitutions distinguish the analog from the natural sequence: D-alanine at position 2, glutamine at position 8, alanine at position 15, and leucine at position 27. These changes slow cleavage by dipeptidyl peptidase IV, the enzyme that degrades native hormone in plasma within minutes. The outcome is improved enzymatic stability combined with a still brief residence time when no additional modification is present.
Naming in this area is inconsistent, and readers should treat product labels with care. In much of the literature and in vendor catalogs, the unqualified term refers to the albumin-binding version, while the version lacking the DAC group appears as modified GRF(1-29), mod GRF(1-29), or the same name with a without-DAC qualifier. Because one abbreviation has been applied to both materials, the only reliable way to identify a sample is to check the stated sequence and the presence of the linker.
Once in circulation, the peptide binds the growth hormone-releasing hormone receptor displayed on pituitary somatotroph cells. Receptor activation couples to Gs proteins, elevates intracellular cyclic AMP, and drives protein kinase A signaling inside the cell. That cascade increases discharge of growth hormone into the bloodstream. The analog therefore operates through a receptor pathway that already exists for the body's own releasing hormone, rather than through an engineered artificial target.
Clearance profiles diverge sharply between the two versions. The albumin-binding molecule stays in plasma for several days, whereas the unmodified analog is largely gone within about half an hour in reported work. Cleavage by dipeptidyl peptidase IV is a major contributor to the short life of the unmodified sequence. These gaps mean the two versions cannot be substituted for each other in study design or in reading results side by side.
| Property | Value | Notes |
|---|---|---|
| Molecular class | Synthetic peptide | GHRH analog, not a steroid |
| Backbone length | 29 amino acids | Based on GRF(1-29) |
| Substitutions | Four positions | D-Ala2, Gln8, Ala15, Leu27 |
| Appearance | White to off-white powder | Typical lyophilized research material |
| Common synonyms | Modified GRF(1-29) | Usage varies between sources |
Lyophilized peptide powder is comparatively stable when kept dry, cold, and protected from light. Once dissolved, the molecule is vulnerable to deamidation, oxidation, and aggregation, with the rate depending on pH, buffer composition, and temperature. Alkaline conditions and repeated freeze-thaw cycles accelerate loss of the intact peptide. The methionine present in the native sequence is a known oxidation site, which is one reason it was replaced in the modified fragment. Suppliers typically recommend cold storage of solutions and use within a short window.
Analytical confirmation usually relies on reversed-phase high-performance liquid chromatography for purity and on liquid chromatography coupled to mass spectrometry for identity. Mass data reveal the expected molecular mass and can flag truncated or oxidized species. Amino acid analysis and peptide mapping provide sequence-level verification. Immunoassays are used in some biological matrices, but antibodies raised against one releasing-hormone analog may cross-react with another. Reported purity figures depend heavily on the method used, so comparisons between suppliers require matching the analytical approach.
The two variants differ dramatically in how long they persist in circulation. The form lacking the albumin-binding group has a plasma half-life measured in tens of minutes, comparable to the natural hormone fragment. The version carrying the drug affinity complex binds albumin and shows a half-life of roughly six to eight days in human studies. That figure comes from small trials that tracked hormone levels over extended periods. The physiological consequences of sustained versus pulsatile stimulation are still debated and the literature does not settle the point.
Studies in this area generally track growth hormone pulses, insulin-like growth factor 1 concentrations, and occasionally body composition endpoints. Most published human data come from early, small trials, and questions about long-term effects remain open. Whether repeated exposure alters pituitary responsiveness over time is not settled. Analytical work relies on immunoassays for the hormones and on mass spectrometry for the peptide itself, because the two measurements answer different questions.
Binding of the peptide to the growth hormone-releasing hormone receptor on pituitary somatotrophs triggers a G protein coupled cascade that raises cyclic AMP and opens calcium channels. The result is greater secretion of growth hormone into the bloodstream. Because the peptide acts at the same receptor as the natural hypothalamic hormone, its effect is amplified pulse size rather than an entirely separate release pathway. Receptor binding alone does not determine the response, since somatostatin tone and other inputs modulate the final output.
The albumin-binding version stays in circulation for days, because covalent attachment to serum albumin shields the peptide from rapid filtration and degradation. Reported half-lives for this form fall in the range of several days. The version without the linker is cleared in minutes, with estimates often near thirty minutes in animal work. These figures come from small studies and vary with assay method, species, and route, so they are best read as approximate rather than fixed constants.
Four amino acid substitutions separate the modified backbone from the parent GRF(1-29) sequence. These changes reduce recognition by dipeptidyl peptidase IV and related proteases, extending the interval before degradation. Development work in this area sought longer-acting GHRH analogs for endocrine investigation. Published descriptions treat the substitution set as a defining property of the core sequence, while the albumin-binding linker is described separately as an optional addition to that same backbone.
CJC-1295 is a synthetic peptide analog of growth hormone-releasing hormone, constructed on the 29-amino-acid fragment designated GRF(1-29). The name began as an internal development code during the 1990s and later spread through research supply catalogs and discussion forums. The molecule does not occur in nature; its sequence is engineered rather than isolated from tissue. Two related compounds are sold under this single label, and they differ by one appended chemical group that strongly influences how long the peptide remains in circulation.
Cecropin A Peptide Sequence (KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK). Secondary structure includes two α helices. At low peptide to lipid ratios ion channels are formed, at high peptide to lipid ratios pores are formed. Cecropin B Peptide Sequence (KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL). Secondary structure includes two α helices. CECD from Aedes aegypti (Yellowfever mosquito). Papiliocin from Papilio xuthus (a butterfly) Cecropin P1 Peptide Sequence (SWLSKTAKKLENSAKKRISEGIAIAIQGGPR). An antibacterial peptide from Ascaris suum, a parasitic nematode that resides in the pig intestine, also belongs to this family.
== Alternative carbon fixation pathways == RuBisCO is important biologically because it catalyzes the primary chemical reaction by which inorganic carbon enters the biosphere. While many autotrophic bacteria and archaea fix carbon via the reductive acetyl CoA pathway, the 3-hydroxypropionate cycle, or the reverse Krebs cycle, these pathways are relatively small contributors to global carbon fixation compared to that catalyzed by RuBisCO. Phosphoenolpyruvate carboxylase, unlike RuBisCO, only temporarily fixes carbon. Reflecting its importance, RuBisCO is the most abundant protein in leaves, accounting for 50% of soluble leaf protein in C3 plants (20–30% of total leaf nitrogen) and 30% of soluble leaf protein in C4 plants (5–9% of total leaf nitrogen). Given its important role in the biosphere, the genetic engineering of RuBisCO in crops is of continuing interest (see below).
DNA was first isolated by the Swiss physician Friedrich Miescher who, in 1869, discovered a microscopic substance in the pus of discarded surgical bandages. As it resided in the nuclei of cells, he called it "nuclein". In 1878, Albrecht Kossel isolated the non-protein component of "nuclein", nucleic acid, and later isolated its five primary nucleobases. In 1909, Phoebus Levene identified the base, sugar, and phosphate nucleotide unit of RNA (then named "yeast nucleic acid"). In 1929, Levene identified deoxyribose sugar in "thymus nucleic acid" (DNA). Levene suggested that DNA consisted of a string of four nucleotide units linked together through the phosphate groups ("Tetranucleotide hypothesis"). Levene thought the chain was short and the bases repeated in a fixed order. In 1927, Nikolai Koltsov proposed that inherited traits would be inherited via a "giant hereditary molecule" made up of "two mirror strands that would replicate in a semi-conservative fashion using each strand as a template". In 1928, Frederick Griffith in his experiment discovered that traits of the "smooth" form of Pneumococcus could be transferred to the "rough" form of the same bacteria by mixing killed "smooth" bacteria with the live "rough" form. This system provided the first clear suggestion that DNA carries genetic information. In 1933, while studying virgin sea urchin eggs, Jean Brachet suggested that DNA is found in the cell nucleus and that RNA is present exclusively in the cytoplasm.
Sources: en.wikipedia.org
Mestanolone, also known as methylandrostanolone and sold under the brand names Androstalone and Ermalone among others, is an androgen and anabolic steroid (AAS) medication which is mostly no longer used. It is still available for use in Japan however. It is taken by mouth. Side effects of mestanolone include symptoms of masculinization like acne, increased hair growth, voice changes, and increased sexual desire. It can also cause liver damage. The drug is a synthetic androgen and anabolic steroid and hence is an agonist of the androgen receptor (AR), the biological target of androgens like testosterone and dihydrotestosterone (DHT). It has strong androgenic effects and weak anabolic effects, which make it useful for producing masculine psychological and behavioral effects. The drug has no estrogenic effects. Mestanolone was discovered in 1935 and was introduced for medical use in the 1950s. In addition to its medical use, mestanolone has been used to improve physique and performance. It was used in East Germany in Olympic athletes as part of a state-sponsored doping program in the 1970s and 1980s. The drug is a controlled substance in many countries and so non-medical use is generally illicit.
== Additional features == In addition to the twelve sections of HPA, exploring gene and protein expression, there are various features available at the HPA website to assist the research community, including integrated external resources, such as Metabolic Atlas, educational material and free downloadable data.
=== 1974–1977: Arrival of Neil Peart and foray into progressive rock === After auditioning five drummers, Lifeson and Lee picked Neil Peart, who joined on July 29, 1974, which was two weeks before the group's first US tour. They performed their first concert together on August 14 at the Civic Arena in Pittsburgh, opening for Uriah Heep and Manfred Mann's Earth Band to more than 11,000 people. Peart assumed the role of lyricist; Lifeson and Lee had little interest in the job and recognized Peart's wider vocabulary range from reading regularly. Lifeson and Lee focused primarily on the music, with the new material displaying their influences from progressive rock bands Yes and Pink Floyd. When the U.S. tour concluded in December 1974, Rush had reached its peak of No. 105 on the U.S. Billboard 200 chart. Fly by Night (1975), Rush's first album with Peart, saw the inclusion of the story song "By-Tor & the Snow Dog", replete with complex arrangements and a multi-section format. Lyrical themes also underwent dramatic changes because of Peart's love for fantasy and science-fiction literature. Despite the new styles, some other songs on the album mirrored the simplistic blues style found on Rush's debut. "Fly by Night" was released as a single that reached No. 45 in Canada. The album reached No. 9 in Canada, where it was certified platinum by the Canadian Recording Industry Association (CAN) for selling 100,000 copies and by the Recording Industry Association of America (RIAA) for selling 1 million copies in the U.S. Caress of Steel (1975) followed Fly by Night.
Rosemary Kennedy, sister of US president John F. Kennedy, underwent a lobotomy in 1941 that left her incapacitated and institutionalized for the rest of her life. Howard Dully wrote a memoir of his late-life discovery that he had been lobotomized in 1960 at age 12. Josef Hassid, a Polish violinist and composer, was diagnosed with schizophrenia and died at the age of 26 following a lobotomy performed on him in England. Swedish modernist painter Sigrid Hjertén died following a lobotomy in 1948. American playwright Tennessee Williams's older sister Rose received a lobotomy that left her incapacitated for life; the episode is said to have inspired characters and motifs in some of his works. It is often said that when an iron rod was accidentally driven through the head of Phineas Gage in 1848, this constituted an "accidental lobotomy", or that this event somehow inspired the development of surgical lobotomy a century later. According to the only book-length study of Gage, careful inquiry turns up no such link. In 2011, Daniel Nijensohn, an Argentine-born neurosurgeon at Yale, examined X-rays of Eva Perón and concluded that she underwent a lobotomy for the treatment of pain and anxiety in the last months of her life.
Sources: en.wikipedia.org
Fresh lotus seeds (simplified Chinese: 莲子; traditional Chinese: 蓮子; pinyin: liánzǐ; Cantonese Yale: lìhnjí،, Kashmiri: Pambach) are nutritious but also vulnerable to microbial contamination, especially fungal infections. Therefore, mostly dry lotus seed-based products are found on the market. Traditional sun baking combined with charcoal processing dries the seeds but results in a loss of nutrients. Freeze-dried lotus seeds have a longer shelf life and maintain original nutrients, while no differences in flavour are found after rehydration compared to fresh lotus seeds. Dry stored lotus seeds are sensitive to moisture and mold infestation; researchers continue to explore new ways to preserve fresh lotus seeds, such as radiation processing. Lotus seeds can be processed into fillings for moon cake, lotus seed noodles and food in the forms of paste, fermented milk, rice wine, ice cream, popcorn (phool makhana), and others, with lotus seeds as the main raw material. Traditional Chinese medicine claims that fresh lotus seed wine has thirst-quenching, spleen-healing, and anti-diarrheal advantages after drinking, attributed to unspecified bioactive compounds. Lotus seed tea and lotus fruit tea is consumed in Korea, and lotus embryo tea is consumed in China and Vietnam.
7 April South Vietnamese President Nguyễn Văn Thiệu announced that once PAVN forces were withdrawn from South Vietnam, former VC could participate in the political process but not as part of the VC or any other communist organization. This was rejected the next day by a VC spokesman in Paris.
In a 2023 survey of 14 European newborn screening programs, there was one pan-European research study with 2 pilot trials planned in Germany (NEW_LIVES) and Italy, the others included three initiatives in Italy, three in the Netherlands, two in Spain, one in Belgium, one in England, one in Germany, one in Greece and one in France. Of the 14 initiatives, 11 selected a single NGS approach for their studies: 6 initiatives planned to use only whole genome sequencing (WGS) as a first-tier test for NBS, including one also testing parents using whole exome sequencing (WES) to facilitate filtering variants, 3 initiatives use classical NGS gene panels, 2 initiatives will be using WES and 2 initiatives will use a mixed approach: one comparing WES and Whole genome sequencing (WGS) and one comparing WES, WGS, and classical NGS. gene panels.
=== Manufacturer === The company the makes Cetacaine is called Cetylite Industries, Inc. This company is based out of Pennsauken, NJ and has a total of 75 employees. Cetylite brings in total revenue of around $7,500,000 with their main product being the topical anesthetics, and infection prevention products.
Plant-based diet The plant-based diet is largely based on consumption of beans, grains, fruits, and vegetables and removal of meat, fish, and occasionally dairy and egg products from intake. In other words, fiber and unsaturated fat intake is increased and consumption of higher calorie meats and saturated fats is decreased. This diet has been shown to reduce BMI and introduce positive body composition changes when compared to a carnivore diet. Plant-based diets provide a lot of fiber in the meals which allows the body to lose weight and keep that weight off. Removing fried foods such as french fries, donuts, potato chips, and fried chicken, and sticking to an all plant-based diet comes with a lot of positive and healthy benefits.
Sources: en.wikipedia.org
No. It is a laboratory-made analog of growth hormone-releasing hormone. The natural hormone is a 44-residue peptide, while the analog is built on a shorter 29-residue fragment.
The original material included a linker that binds serum albumin. A later variant removed that linker to reduce the duration of action. Catalogs and papers did not consistently adopt separate names, so both remain widely labeled with the same term.
The amino acid sequence and the presence or absence of the linker group. Mass measured by spectrometry gives an independent check that separates the two forms.
It acts on the growth hormone-releasing hormone receptor found on pituitary somatotroph cells. Activation of that receptor triggers growth hormone release through a cyclic AMP dependent pathway.