reverse-phase HPLC is one of those subjects where the details matter more than the headlines. This page pulls together the background, the mechanisms, and the practical points readers ask about most.
Last reviewed on 2025-08-19. Where a claim depends on a specific study, the study is described rather than over-claimed.
CJC-1295 is a synthetic peptide designed as a long-acting analogue of growth hormone-releasing hormone (GHRH). Its structure derives from the first 29 amino acids of native GHRH, a fragment often called GRF(1-29). Four substitutions were introduced to slow enzymatic breakdown and extend activity relative to the natural sequence. The compound was developed by ConjuChem as part of a broader effort to improve the pharmacokinetic profile of peptide hormones. It is studied in laboratory and clinical research settings rather than appearing as a naturally occurring substance.
Two related forms circulate in technical discussion under the same family name. The original version carries a drug affinity complex (DAC) that binds covalently to serum albumin after administration, and this linkage substantially extends circulation time. A second form, frequently written as modified GRF(1-29) or CJC-1295 without DAC, lacks that linker and clears much faster. The naming is a frequent source of confusion because the shorthand CJC-1295 can refer to either form depending on the source. Reports sometimes fail to specify which variant was studied.
Reverse-phase high-performance liquid chromatography is the standard tool for purity assessment. The technique separates the target peptide from truncated or modified byproducts. Mass spectrometry confirms molecular weight and supports sequence verification. Electrospray ionization and matrix-assisted laser desorption are both used. Amino acid analysis provides an independent check on composition. Purity values are commonly reported as area percentage from the chromatogram. Residual trifluoroacetate and water content are also measured in many quality programs.
Batch-to-batch consistency depends on solid-phase peptide synthesis and subsequent purification. Coupling efficiency, resin choice, and cleavage conditions all affect the final profile. Counter-ion content and moisture can shift the apparent mass of a batch. Documentation typically includes a certificate of analysis with chromatograms and spectra. Independent verification by a second laboratory is sometimes requested. Whether a given certificate reflects the actual vial contents depends on chain of custody. Analytical methods themselves carry uncertainty that should be stated alongside results.
| Property | Value | Notes |
|---|---|---|
| Molecular weight (no linker) | ~3.37 kDa | Calculated from peptide sequence |
| Molecular weight (with linker) | ~3.65 kDa | Includes albumin-binding moiety |
| Appearance | White to off-white powder | Typically lyophilized |
| Solubility | Soluble in water | Also dissolves in aqueous buffers |
| Common synonyms | Modified GRF(1-29), DAC:GRF | Usage varies by source |
At the pituitary, the peptide binds the growth hormone-releasing hormone receptor on somatotroph cells. Receptor activation raises intracellular cyclic AMP and triggers release of stored growth hormone. Somatostatin and other hypothalamic signals modulate this response. Negative feedback from insulin-like growth factor 1 also influences output. The same regulatory architecture operates with the native hormone. Whether the synthetic analog alters feedback dynamics over repeated exposure remains an open question. Most published receptor work uses cell models rather than intact human systems.
CJC-1295 is a synthetic peptide belonging to the growth hormone-releasing hormone analog family. It comprises twenty-nine amino acid residues derived from the N-terminal region of natural GHRH. The molecule incorporates several non-natural substitutions that increase resistance to enzymatic degradation. These modifications extend its activity compared with the native hormone fragment. Researchers use it to study pituitary growth hormone secretion in laboratory and clinical settings. This compound is distinct from native GHRH in its stability profile.
Two principal forms appear in the literature and in research supply. One carries a drug affinity complex, a maleimide-based group that forms a covalent bond with circulating albumin. This linkage slows clearance and produces a long-lasting elevation of peptide levels. The other form lacks that group and is often labeled MOD GRF(1-29). It has a much shorter circulation time. Both variants retain the same core receptor-binding sequence. Reported half-lives differ substantially between the two.
Lyophilized material is generally stable for extended periods when held at minus twenty degrees Celsius or below and protected from moisture and light. In solution the peptide is more labile; bond hydrolysis, aggregation and oxidation of susceptible residues all proceed faster at ambient temperature. Repeated freeze and thaw cycles should be avoided because they promote clumping and loss of soluble material. The conjugated variant adds a further consideration, since the maleimide group can hydrolyze in aqueous buffer and lose its ability to react with albumin.
Laboratory handling centers on minimizing exposure to water, heat and oxygen before use. Working solutions are typically prepared in sterile water or a mild buffer, and any residual particulate matter is removed by filtration. When the powder dissolves slowly, a small proportion of acetonitrile or dilute acetic acid is sometimes added as a co-solvent. Containers are kept sealed and desiccated between uses. Records of lot number, reconstitution date and storage conditions support later comparison of results across experiments.
HN MAPRGESCLLLLTSEIDLPVKRRA S1 MCHWAGGASNTGDARGDVFGKQAG S2 MGVKFFTLSTREFPSVQRAVPLWTNS S3 MLGYNFSSFPCGTISIAPGENFYRLYFIWVNGLAKVVW S4 MLEVMELVNRRGKICRVPETFFNLSL S5 MYCSEVGFCSEVAPTEIFNAGLWV S6 MLDQDIPMVQPLLKVRLEND
==== Respiratory system ==== The respiratory system allows for gas exchange, particularly of carbon dioxide and oxygen, in human beings. In the process of breathing or ventilation, the muscles of respiration pump air into the lungs, bringing it into close contact with the blood via millions of microscopic air sacs known as alveoli. The upper respiratory tract includes the nose, nasal cavities, sinuses, pharynx and the part of the larynx above the vocal folds; the lower tract includes the lower part of the larynx and the following aiways: the trachea, bronchi, bronchioles and alveoli. The lungs are surrounded by flattened closed sacs known as pleura.
==== Europe ==== In 2008, the European Monitoring Centre for Drugs and Drug Addiction noted that although there were some reports of tablets being sold for as little as €1, most countries in Europe then reported typical retail prices in the range of €3 to €9 per tablet, typically containing 25–65 mg of MDMA. By 2014 the EMCDDA reported that the range was more usually between €5 and €10 per tablet, typically containing 57–102 mg of MDMA, although MDMA in powder form was becoming more common.
== Available software == Though using bioinformatic technology to develop vaccines has become typical in the past ten years, general laboratories often do not have the advanced software that can do this. However, there are a growing number of programs making reverse vaccinology information more accessible. NERVE is one relatively new data processing program. Though it must be downloaded and does not include all epitope predictions, it does help save some time by combining the computational steps of reverse vaccinology into one program. Vaxign, an even more comprehensive program, was created in 2008. Vaxign is web-based and completely public-access. Though Vaxign has been found to be extremely accurate and efficient, some scientists still utilize the online software RANKPEP for the peptide bonding predictions. Both Vaxign and RANKPEP employ PSSMs (Position Specific Scoring Matrices) when analyzing protein sequences or sequence alignments. Computer-Aided bioinformatics projects are becoming extremely popular, as they help guide the laboratory experiments.
Sources: en.wikipedia.org
Direct interaction with DNA is the simplest and the most direct method by which a protein changes transcription levels. Genes often have several protein binding sites around the coding region with the specific function of regulating transcription. There are many classes of regulatory DNA binding sites known as enhancers, insulators and silencers. The mechanisms for regulating transcription are varied, from blocking key binding sites on the DNA for RNA polymerase to acting as an activator and promoting transcription by assisting RNA polymerase binding. The activity of transcription factors is further modulated by intracellular signals causing protein post-translational modification including phosphorylation, acetylation, or glycosylation. These changes influence a transcription factor's ability to bind, directly or indirectly, to promoter DNA, to recruit RNA polymerase, or to favor elongation of a newly synthesized RNA molecule. The nuclear membrane in eukaryotes allows further regulation of transcription factors by the duration of their presence in the nucleus, which is regulated by reversible changes in their structure and by binding of other proteins. Environmental stimuli or endocrine signals may cause modification of regulatory proteins eliciting cascades of intracellular signals, which result in regulation of gene expression. It has become apparent that there is a significant influence of non-DNA-sequence specific effects on transcription.
Nucleolus Nuclear speckle Cajal body Paraspeckle Synaptonemal complex Other nuclear structures including heterochromatin form by mechanisms similar to phase separation, so can also be classified as biomolecular condensates. RNAs with triplet expansion that produce neurodegenerative disorders can also independently form RNA foci in vitro or in mammalian nuclei. This phenomenon is further reconsituted in bacteria E. coli, by expressing engineered CAG repeats, providing strong evidence that these RNA repeats phase separate without the need of additional proteins.
Produced by Patrick Uden, directed by Taghi Amirani, made by Uden Associates 6 August New York! New York!, about sewage; New York makes enough sewage each day to fill the Yankee Stadium ten times, with seven million people; it had 80,000 miles of electric cable; a new sewage tunnel 60 miles long, 800 ft below ground, was being built, to be finished in the next century - the New York City Water Tunnel No. 3 is expected to be finished by 2032 13 August Fatal Attraction, about road transport; Britain subsidised rail £2 per mile, West Germany was £5 per mile; Reinhard Gutter of Cologne; traffic calming hadmainly begun in West Germany, from 1976; John Whitelegg; transport psychologist Carina van Knippenburg of the University of Gronigen; in 1987, the Dutch government introduced rationing of car transport, also trialled in Hong Kong; Ian Catling, and road pricing; Martin Paget in Birmingham; Talib Rothengatter, and the resignation of the Dutch government in April 1989; Philip Goodwin; Martin Mogridge of UCL. Narrated by Simon Ward, produced by Stewart Lansley, directed by Andy Mayer, made by Juniper Productions 20 August The Defender, building a new fighter plane in Canada; Chris Ball, of Bristol Aerospace in Winnipeg, and Bob Diemert are building a fighter plane in Carman, Manitoba; Bob Diemert flew one of his restored Hurricane XII aircraft in the 1969 Battle of Britain; the Commemorative Air Force at Harlingen, Texas; his plane attempts to take off, but it is something akin to a scene from Those Magnificent Men in Their Flying Machines.
== Quantification using two dimensional electrophoresis == Two-dimensional gel electrophoresis (2-DE) represents one of the main technologies for quantitative proteomics with advantages and disadvantages. 2-DE provides information about the protein quantity, charge, and mass of the intact protein. It has limitations for the analysis of proteins larger than 150 kDa or smaller than 5kDa and low solubility proteins. Quantitative MS has higher sensitivity but does not provide information about the intact protein. Classical 2-DE based on post-electrophoretic dye staining has limitations: at least three technical replicates are required to verify the reproducibility. Difference gel electrophoresis (DIGE) uses fluorescence-based labeling of the proteins prior to separation has increased the precision of quantification as well as the sensitivity in the protein detection. Therefore, DIGE represents the current main approach for the 2-DE based study of proteomes.
. However, away from this reference point, errors will accumulate over time thus convergence test is needed to find an optimal time step for more accurate results. Among these three reproduction numbers,
Sources: en.wikipedia.org
=== Advancing women in academia === Masur aims to advance and increase the visibility of women in STEMM. She uses her voice to create opportunities for women in science and fights for more equitable academic space. During her tenure at Mount Sinai, Masur was the first Dean of Faculty Developmencreating mentorship opportunities for women and men . She is a member of the Office of Gender Equity as Director of the Office for Women's Careers, which evolved from the Women Faculty Group at Mount Sinai (established in 1986). As the Director of the Office of Women's Careers, she advocates for women at ISMMS. Targeted programs and monthly events are hosted for women to discuss juggling career with family and to provides them with mentorship and leadership opportunities. Masur has published works describing the development of Women in Cell Biology (WICB) as well as anticipations of the future of women in STEMM. Masur held leadership roles including Chair of Diversity Issues Committee on Women and Minorities for the Association for Research in Vision and Ophthalmology from 1997 to 1999, co-director of the National Eye Institute's "Fundamental Issues in Vision Research" at the Marine Biological Laboratory from 2001 to 2010, and Chair of Women in Cell Biology for the American Society of Cell Biology from 2010 to 2016. In 2015 the American Society for Cell Biology honored Masur by naming one of their leadership awards the "Sandra K. Masur Senior Leadership Award" for efforts in scientific leadership and her long history of creating opportunities for women.
Because ESI allows for online droplet detection, other problems posed by segmented or off-chip detection based systems can be solved, such as the minimizing of sample (droplet) dilution, which is especially critical to microfluidic droplet detection where analyte samples are already diluted to the lowest experimentally relevant concentration.
=== Distribution === After absorption, the alcohol goes through the portal vein to the liver, then through the hepatic veins to the heart, then the pulmonary arteries to the lungs, then the pulmonary veins to the heart again, and then enters systemic circulation. Once in systematic circulation, ethanol distributes throughout the body, diffusing passively and crossing all biological membranes including the blood–brain barrier. At equilibrium, ethanol is present in all body fluids and tissues in proportion to their water content. Ethanol does not bind to plasma proteins or other biomolecules. The rate of distribution depends on blood supply, specifically the cross-sectional area of the local capillary bed and the blood flow per gram of tissue. As such, ethanol rapidly affects the brain, liver, and kidneys, which have high blood flow. Other tissues with lower circulation, such as skeletal muscles and bone, require more time for ethanol to distribute into. In rats, it takes around 10–15 minutes for tissue and venous blood to reach equilibrium. Peak circulating levels of ethanol are usually reached within a range of 30 to 90 minutes of ingestion, with an average of 45 to 60 minutes. People who have fasted overnight have been found to reach peak ethanol concentrations more rapidly, at within 30 minutes of ingestion. The volume of distribution Vd contributes about 15% of the uncertainty to Widmark's equation and has been the subject of much research.
=== 4 February === At least six people were killed by RSF shelling on the al-Nao hospital in Omdurman. The SAF claimed to have retaken al-Kamelin and laid siege to the town of Naima in White Nile State. Engineers from the Khartoum State Water Authority were fired at by RSF snipers stationed at the Kuwaiti building while they were assessing the damage to the Bahri Water Plant.
Sources: en.wikipedia.org
No. It is a synthetic analogue modeled on the first 29 residues of human GHRH. The substitutions and any linker are laboratory modifications rather than features of the endogenous peptide.
Early development used the albumin-binding form, and a shorter variant was later discussed under the same label. Because the two differ in half-life and handling, ambiguity arises whenever a source omits the variant designation.
The compound derives from that fragment but is not identical to it. The parent fragment lacks the stabilizing substitutions, so its degradation rate and duration of action differ noticeably.
The powder is normally held at minus twenty degrees Celsius or below. Light and moisture exposure should be minimized. Repeated warming and cooling cycles are avoided.