A practical reference on Mod GRF(1-29): what it is, how it behaves, what the literature reports, and where the honest uncertainties sit.
Reviewed 2025-11-20. Anything still debated is marked as such rather than presented as settled.
The dividing feature between the two forms is a maleimide-based drug affinity complex, abbreviated DAC. In the DAC-bearing version, a linker attaches the peptide to serum albumin after administration, and that association slows removal from plasma. The version lacking DAC appears in catalogs as MOD GRF(1-29) or tetrasubstituted GRF(1-29). Because informal writing treats both as one item, comparisons drawn from such sources routinely blend measurements taken from two molecules with substantially different behavior.
Four amino acid substitutions separate the modified backbone from the parent GRF(1-29) sequence. These changes reduce recognition by dipeptidyl peptidase IV and related proteases, extending the interval before degradation. Development work in this area sought longer-acting GHRH analogs for endocrine investigation. Published descriptions treat the substitution set as a defining property of the core sequence, while the albumin-binding linker is described separately as an optional addition to that same backbone.
CJC-1295 is a synthetic peptide analog of growth hormone-releasing hormone, constructed on the 29-amino-acid fragment designated GRF(1-29). The name began as an internal development code during the 1990s and later spread through research supply catalogs and discussion forums. The molecule does not occur in nature; its sequence is engineered rather than isolated from tissue. Two related compounds are sold under this single label, and they differ by one appended chemical group that strongly influences how long the peptide remains in circulation.
Receptor level activity follows the canonical GHRH pathway. The peptide binds the GHRH receptor, a class B G protein coupled receptor on somatotroph cells of the anterior pituitary. Binding raises intracellular cyclic AMP, which promotes calcium entry and the release of growth hormone into the bloodstream. Because the molecule acts at the same receptor as the endogenous hormone, its effect is superimposed on the natural pulsatile rhythm rather than replacing it. Whether sustained receptor occupation leads to desensitization is not fully settled.
CJC-1295 belongs to a class of synthetic peptides modeled on growth hormone releasing hormone, a forty-four amino acid signal produced by the hypothalamus. The compound is built from the first twenty-nine residues of the natural sequence, with four substitutions introduced at positions 2, 8, 15 and 27. These changes were designed to slow enzymatic breakdown while preserving receptor activation. The result is a peptide that is shorter than native GHRH and considerably more resistant to ordinary clearance pathways in circulation.
Two related forms appear under the CJC-1295 name. The simpler analogue, commonly written as modified GRF(1-29), carries the four substitutions but no additional conjugation. The second form attaches a maleimidopropionic acid linker to a lysine residue, a modification frequently called the drug affinity complex. That linker reacts with the free thiol on serum albumin to form a covalent bond. Because albumin has a long residence time in blood, the conjugated peptide stays in circulation far longer than the unconjugated analogue.
| Property | Value | Notes |
|---|---|---|
| Molecular class | Synthetic peptide | Analog of growth hormone-releasing hormone |
| Chain length | 29 amino acids | Based on the GRF(1-29) fragment |
| Appearance | White to off-white lyophilized powder | Common research supply form |
| Solubility | Soluble in water and aqueous buffers | Powder requires reconstitution before use |
| Typical storage | −20 °C or below | Kept away from light and moisture |
Pharmacokinetic behaviour differs sharply between the two forms. The DAC-bearing peptide shows an extended circulation time measured in days, whereas the version without the complex is cleared within roughly half an hour. This gap shapes how researchers design dosing schedules in animal models. Whether the prolonged presence of the DAC form produces effects meaningfully different from the short-acting variant remains an open question, since comparative human data are scarce.
CJC-1295 is a synthetic peptide designed to mimic growth hormone-releasing hormone (GHRH), the endogenous signal that prompts the pituitary gland to release growth hormone. The compound is a modified fragment of the natural hormone, spanning the first twenty-nine amino acids of GHRH with several substitutions that slow enzymatic breakdown. Two variants circulate in research settings: one carrying a drug affinity complex (DAC) and one without it. The DAC-free form is frequently labelled Mod GRF(1-29) in catalogs and discussion forums.
Identity and purity are assessed mainly by reversed-phase high-performance liquid chromatography combined with mass spectrometry. The chromatographic separation resolves the target peptide from truncation products and from species carrying oxidised residues, while mass measurement confirms the expected molecular mass. Because the two common variants differ by roughly 280 daltons, a mass determination distinguishes them unambiguously. Purity is often quoted as a percentage of total peak area, although that figure depends on the detection wavelength and the integration method applied.
Reported half-lives differ widely between the two variants and between species. Values for the albumin-binding form are usually expressed in days, while the unconjugated form is measured in minutes to a few hours. Sampling schedules, assay sensitivity, and route of administration all influence the numbers, which limits direct comparison across studies. Whether sustained receptor occupancy produces different downstream effects from pulsatile stimulation remains an open question in the published work. Claims about relative potency should therefore be read alongside the specific study design that produced them.
Lyophilised powder is the usual supplied form. The material is hygroscopic, so vials are typically equilibrated to room temperature before opening in order to prevent condensation on the contents. Long-term storage is generally described at minus twenty degrees Celsius or colder, protected from light and moisture. Repeated freeze-thaw cycles are avoided because they promote aggregation and loss of soluble material. A reconstituted solution is considerably less stable than the dry powder and is normally kept refrigerated for short periods only.
Antithrombotic medication. These are commonly given because thromboembolism is the major cause of arterial embolism. Examples are: Anticoagulants (such as warfarin or heparin) and antiplatelet medication (such as aspirin, ticlopidine, and clopidogrel) can prevent new clots from forming Thrombolytics (such as streptokinase) can dissolve clots Painkillers given intravenously Vasodilators to relax and dilate blood vessels. Appropriate drug treatments successfully produce thrombolysis and removal of the clot in 50% to 80% of all cases. Antithrombotic agents may be administered directly onto the clot in the vessel using a flexible catheter (intra-arterial thrombolysis). Intra-arterial thrombolysis reduces thromboembolic occlusion by 95% in 50% of cases, and restores adequate blood flow in 50% to 80% of cases. Surgical procedures include:
Boletus edulis (English: cep, penny bun, porcino) is a basidiomycete fungus, and the type species of the genus Boletus. It is prized as an edible mushroom. The fungus produces spore-bearing fruit bodies above ground in summer and autumn. The fruit body has a large brown cap which can reach 30 cm (12 in) in diameter and 3 kg (6 lb 10 oz) in weight. Like other boletes, it has tubes extending downward from the underside of the cap, rather than gills; spores escape at maturity through the tube openings (pores). The pore surface of the fruit body is whitish when young, aging to a greenish-yellow. The stout stipe (or stem) is white or yellowish, up to 25 cm (10 in) tall and 7 cm (3 in) thick, and partially covered with a raised network pattern (reticulations). The fungus grows in deciduous and coniferous forests and tree plantations, forming symbiotic ectomycorrhizal associations with living trees by enveloping the tree's underground roots with sheaths of fungal tissue. Widely distributed in the Northern Hemisphere across Eurasia and North America, it does not occur naturally in the Southern Hemisphere but has been introduced to it. Several closely related European mushrooms formerly thought to be varieties or forms of B. edulis have been shown using molecular phylogenetic analysis to be distinct species, while others previously classified as separate species are conspecific with B. edulis. The western North American species commonly known as the California king bolete (B. edulis var. grandedulis) is a large, darker-coloured variant first formally identified in 2007. B.
Integrated multi-trophic aquaculture (IMTA) is a practice in which the byproducts (wastes) from one species are recycled to become inputs (fertilizers, food) for another. Fed aquaculture (for example, fish, shrimp) is combined with inorganic extractive and organic extractive (for example, shellfish) aquaculture to create balanced systems for environmental sustainability (biomitigation), economic stability (product diversification and risk reduction) and social acceptability (better management practices). "Multi-trophic" refers to the incorporation of species from different trophic or nutritional levels in the same system. This is one potential distinction from the age-old practice of aquatic polyculture, which could simply be the co-culture of different fish species from the same trophic level. In this case, these organisms may all share the same biological and chemical processes, with few synergistic benefits, which could potentially lead to significant shifts in the ecosystem. Some traditional polyculture systems may, in fact, incorporate a greater diversity of species, occupying several niches, as extensive cultures (low intensity, low management) within the same pond. A working IMTA system can result in greater total production based on mutual benefits to the co-cultured species and improved ecosystem health, even if the production of individual species is lower than in a monoculture over a short-term period. Sometimes the term "integrated aquaculture" is used to describe the integration of monocultures through water transfer.
The War of the Fifth Coalition ended with the Treaty of Schönbrunn (14 October 1809). In the east, only the Tyrolese rebels led by Andreas Hofer continued to fight the French-Bavarian army until finally defeated in November 1809. In the west, the Peninsular War continued. Economic warfare between Britain and France continued: The British continued a naval blockade of French-controlled territory. Due to military shortages and lack of organisation in French territory, many breaches of the Continental System occurred and the French Continental System was largely ineffective and did little economic damage to Great Britain. Both sides entered further conflicts in attempts to enforce their blockade. As Napoleon realised that extensive trade was going through Spain and Russia, he invaded those two countries; the British fought the United States in the War of 1812 (1812–1815). In 1810, the French Empire reached its greatest extent. Napoleon married Marie-Louise, an Austrian Archduchess, with the aim of ensuring a more stable alliance with Austria and of providing the Emperor with an heir (something his first wife, Joséphine, had failed to do). As well as the French Empire, Napoleon controlled the Swiss Confederation, the Confederation of the Rhine, the Duchy of Warsaw and the Kingdom of Italy. Territories allied with the French included:
Heart tissue, like all cells in the body, needs to be supplied with oxygen, nutrients and a way of removing metabolic wastes. This is achieved by the coronary circulation, which includes arteries, veins, and lymphatic vessels. Blood flow through the coronary vessels occurs in peaks and troughs relating to the heart muscle's relaxation or contraction. Heart tissue receives blood from two arteries which arise just above the aortic valve. These are the left main coronary artery and the right coronary artery. The left main coronary artery splits shortly after leaving the aorta into two vessels, the left anterior descending and the left circumflex artery. The left anterior descending artery supplies heart tissue and the front, outer side, and septum of the left ventricle. It does this by branching into smaller arteries—diagonal and septal branches. The left circumflex supplies the back and underneath of the left ventricle. The right coronary artery supplies the right atrium, right ventricle, and lower posterior sections of the left ventricle. The right coronary artery also supplies blood to the atrioventricular node (in about 90% of people) and the sinoatrial node (in about 60% of people). The right coronary artery runs in a groove at the back of the heart and the left anterior descending artery runs in a groove at the front. There is significant variation between people in the anatomy of the arteries that supply the heart. The arteries divide at their furthest reaches into smaller branches that join at the edges of each arterial distribution.
Sources: en.wikipedia.org
Glucagon-like peptide-2 (GLP-2) is a 33 amino acid peptide with the sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD (see Proteinogenic amino acid) in humans. GLP-2 is created by specific post-translational proteolytic cleavage of proglucagon in a process that also liberates the related glucagon-like peptide-1 (GLP-1). GLP-2 is produced by the intestinal endocrine L cell and by various neurons in the central nervous system. Intestinal GLP-2 is co-secreted along with GLP-1 upon nutrient ingestion. When externally administered, GLP-2 produces a number of effects in humans and rodents, including intestinal growth, enhancement of intestinal function, reduction in bone breakdown and neuroprotection. GLP-2 may act in an endocrine fashion to link intestinal growth and metabolism with nutrient intake. GLP-2 and related analogs (such as Teduglutide) may be treatments for short bowel syndrome, Crohn's disease, osteoporosis and as adjuvant therapy during cancer chemotherapy. GLP-2 has an antidepressant effect in a mouse model of depression when delivered via intracerebroventricular injection. However, a GLP-2 derivative (PAS-CPP-GLP-2) was shown to be efficiently delivered to the brain intranasally, with similar efficacy.
Annular lichen planus Atrophic lichen planus Bullous lichen planus (vesiculobullous lichen planus) Erosive lichen planus Erythema dyschromicum perstans (ashy dermatosis, dermatosis cinecienta) Giant cell lichenoid dermatitis Hepatitis-associated lichen planus Hypertrophic lichen planus (lichen planus verrucosus) Idiopathic eruptive macular pigmentation Inverse lichen planus Keratosis lichenoides chronica (Nékam's disease) Kraurosis vulvae Lichen nitidus Lichen planus actinicus (actinic lichen nitidus, actinic lichen planus, lichen planus atrophicus annularis, lichen planus subtropicus, lichen planus tropicus, lichenoid melanodermatitis, lichenoid melanodermatosis, summertime actinic lichenoid eruption) Lichen planus pemphigoides Lichen planus pigmentosus Lichen planus–lichen sclerosus overlap syndrome Lichen ruber moniliformis Lichen sclerosus (lichen sclerosus et atrophicus) Lichen striatus (Blaschko linear acquired inflammatory skin eruption, linear lichenoid dermatosis) Lichen verrucosus et reticularis Lichenoid trikeratosis Lichenoid dermatitis Lichenoid reaction of graft-versus-host disease Linear lichen planus Mucosal lichen planus Peno-gingival syndrome Ulcerative lichen planus Vulvovaginal gingival syndrome Vulvovaginal lichen planus
== See also == Cosmetic pharmacology Ergogenic use of anabolic steroids List of doping cases in sport List of drugs used by militaries Natural bodybuilding Neuroenhancement Steroid use in American football
Frequent lineup changes followed through the rest of the 1970s, and the band broke up in 1982 with Simmons the only constant member having appeared on all of their albums. In 1987, the Doobie Brothers reformed with Johnston back in the fold. McDonald, who made several guest appearances after their reformation, returned full-time in 2019. The group's sixteen studio albums include six top-ten appearances on the Billboard 200 album chart. Their 1978 album Minute by Minute reached number one for five weeks, and won a Grammy for Best Pop Vocal Performance by a Duo or Group. Their song "What a Fool Believes" from that album, written by McDonald and Kenny Loggins, won two Grammys, including Song of the Year and Record of the Year. The band had 16 Billboard Hot 100 top-40 hits, including "Listen to the Music", "Jesus Is Just Alright", "Long Train Runnin'", "China Grove", "Black Water" (#1 in 1974), "Takin' It to the Streets", "What a Fool Believes" (#1 in 1979), and "The Doctor", all of which receive rotation on classic hits radio stations. They have also released six live albums and numerous greatest hits compilations, including 1976's Best of the Doobies, certified diamond by the RIAA for reaching album sales of ten million copies. The Doobie Brothers were inducted into the Vocal Group Hall of Fame in 2004, and the Rock and Roll Hall of Fame in 2020. The group has sold more than 40 million records worldwide.
=== Patent ductus arteriosus === Paracetamol helps ductal closure in patent ductus arteriosus. It is as effective for this purpose as ibuprofen or indomethacin, but results in less frequent gastrointestinal bleeding than ibuprofen. Its use for extremely low birth weight and gestational age infants, however, requires further study.
Sources: en.wikipedia.org
Ribonucleic acid (RNA) functions in converting genetic information from genes into the amino acid sequences of proteins. The three universal types of RNA include transfer RNA (tRNA), messenger RNA (mRNA), and ribosomal RNA (rRNA). Messenger RNA acts to carry genetic sequence information between DNA and ribosomes, directing protein synthesis and carries instructions from DNA in the nucleus to ribosome . Ribosomal RNA reads the DNA sequence, and catalyzes peptide bond formation. Transfer RNA serves as the carrier molecule for amino acids to be used in protein synthesis, and is responsible for decoding the mRNA. In addition, many other classes of RNA are now known.
=== Pharmacokinetics === Orally administered endoxifen is rapidly absorbed and systemically available. The time to peak (Tmax) is between 4.5 and 6 hours after oral administration. It is not metabolized by cytochrome P450 enzymes. The half-life (t½) life of endoxifen is 52.1 to 58.1 hours.
== Symptoms == Citrus greening is distinguished by the common symptoms of yellowing of the veins and adjacent tissues (hence the "yellow dragon" name given by observing Chaozhou farmers as early as the 1870s); followed by splotchy mottling of the entire leaf, premature defoliation, dieback of twigs, decay of feeder rootlets and lateral roots, and decline in vigor, ultimately followed by the death of the entire plant. Affected trees have stunted growth, bear multiple off-season flowers (most of which fall off), and produce small, irregularly shaped fruit with a thick, pale peel that remains green at the bottom and tastes very bitter. Common symptoms can be mistaken for nutrient deficiencies; the distinguishing factor is the pattern of symmetry. Nutrient deficiencies tend to be symmetrical along the leaf vein margin, while HLB has an asymmetrical yellowing around the vein. The most noticeable symptom of HLB is greening and stunting of the fruit, especially after ripening.
The shot is a liquid volume measure that varies from country to country and state to state depending on legislation. It is routinely used for measuring strong liquor or spirits when the amount served and consumed is smaller than the more common measures of alcoholic "drink" and "pint". There is a legally defined maximum size of a serving in some jurisdictions. The size of a "single" shot is 20–60 ml (0.70–2.11 imp fl oz; 0.68–2.03 US fl oz). The smaller "pony" shot is 20–30 ml (0.70–1.06 imp fl oz; 0.68–1.01 US fl oz). According to Encyclopædia Britannica Almanac 2009, a pony is 0.75 fluid ounces of liquor. According to Wolfram Alpha, one pony is 1 U.S. fluid ounce. "Double" shots (surprisingly not always the size of two single shots, even in the same place) are 40–100 ml (1.4–3.5 imp fl oz; 1.4–3.4 US fl oz). In the UK, spirits are sold in shots of either 25 ml (0.88 imp fl oz; 0.85 US fl oz) (approximating the old fluid ounce) or 35 ml (1.2 imp fl oz; 1.2 US fl oz).
Sources: en.wikipedia.org
No. It is a laboratory-synthesized analog built on a fragment of the natural hormone. The natural peptide is shorter-lived and lacks the stabilizing substitutions found in the synthetic version.
DAC stands for drug affinity complex, a chemical group that binds the peptide to serum albumin. The binding slows clearance and lengthens the time the molecule stays in plasma compared with the unmodified analog.
Because two distinct molecules are discussed under one informal label. The albumin-binding version clears over several days, while the form without that group clears within roughly half an hour. Mixing results from both creates inconsistent figures.
The names are often used interchangeably in casual writing, but they are not strictly identical. Modified GRF(1-29) refers to the unconjugated analogue carrying only the four substitutions. The version sold as CJC-1295 with DAC includes the albumin binding linker and clears much more slowly.