DAC is one of those subjects where the details matter more than the headlines. This page pulls together the background, the mechanisms, and the practical points readers ask about most.
Last reviewed on 2026-08-01. Where a claim depends on a specific study, the study is described rather than over-claimed.
Verification matters because research peptides vary widely in quality. A certificate of analysis is only as reliable as the method behind it, and a single chromatographic trace reveals little about counter-ions, residual solvents, or water content. Independent laboratories commonly pair mass confirmation with chromatographic purity and, where relevant, quantify water along with acetate or trifluoroacetate content. Reported purity figures are not standardized across suppliers, so a stated value such as ninety-eight percent is not directly comparable unless the analytical method, column, and detection wavelength accompany it.
Characterization of this peptide relies on a small set of routine techniques. Reversed-phase high-performance liquid chromatography separates the target from truncated or oxidized by-products and yields a purity estimate when paired with ultraviolet detection near 214 nanometers. Mass spectrometry, either electrospray coupled to liquid chromatography or matrix-assisted laser desorption, confirms that the observed mass matches the value calculated for the expected sequence. Amino acid analysis, and enzymatic digestion followed by fragment mapping, are used when the sequence itself rather than the mass requires verification.
Stability depends heavily on physical state. A lyophilized powder kept dry, desiccated, and shielded from light typically holds its integrity for months to years at minus twenty degrees Celsius, and longer at minus eighty. Once dissolved, the peptide becomes far more vulnerable, since peptide bond hydrolysis, oxidation of susceptible residues, and aggregation all proceed faster in solution. Buffers near neutral pH are generally gentler than strongly acidic or alkaline conditions. Repeated freeze-thaw cycles and exposure to air-liquid interfaces during vigorous mixing cause losses that are easy to overlook.
Receptor level activity follows the canonical GHRH pathway. The peptide binds the GHRH receptor, a class B G protein coupled receptor on somatotroph cells of the anterior pituitary. Binding raises intracellular cyclic AMP, which promotes calcium entry and the release of growth hormone into the bloodstream. Because the molecule acts at the same receptor as the endogenous hormone, its effect is superimposed on the natural pulsatile rhythm rather than replacing it. Whether sustained receptor occupation leads to desensitization is not fully settled.
CJC-1295 belongs to a class of synthetic peptides modeled on growth hormone releasing hormone, a forty-four amino acid signal produced by the hypothalamus. The compound is built from the first twenty-nine residues of the natural sequence, with four substitutions introduced at positions 2, 8, 15 and 27. These changes were designed to slow enzymatic breakdown while preserving receptor activation. The result is a peptide that is shorter than native GHRH and considerably more resistant to ordinary clearance pathways in circulation.
| Property | Value | Notes |
|---|---|---|
| Appearance | White to off-white powder | Assessed by visual inspection under ordinary light |
| Primary analytical method | Reversed-phase liquid chromatography | Purity estimated from peak area at 214 nm |
| Confirmatory method | Mass spectrometry | Observed mass compared with calculated value |
| Powder storage temperature | Minus 20 degrees Celsius | Minus 80 for extended archival periods |
| Solution stability | Hours to days at 2 to 8 degrees Celsius | Influenced by pH, buffer, and concentration |
The core sequence keeps the receptor-binding region of GHRH while replacing four positions that are vulnerable to dipeptidyl peptidase-4 and other proteases. Substitutions at positions 2, 8, 15, and 27 raise metabolic stability relative to the natural hormone. The N-terminal residues remain essential for activity, so changes there generally lower potency. Molecular weight sits near 3368 daltons for the tetrasubstituted analog without the linker, while the albumin-binding form is heavier because of the added maleimide group.
CJC-1295 is a synthetic peptide modeled on growth hormone-releasing hormone, the hypothalamic signal that prompts the pituitary to release growth hormone. Its sequence corresponds to the first twenty-nine residues of human GHRH, with four substitutions that slow enzymatic breakdown. Early descriptions placed the compound in research on growth hormone deficiency and related conditions, and later literature groups it with the long-acting GHRH analogs. The name appears in both laboratory and popular fitness writing, where it sometimes labels chemically different peptides.
Two related peptides circulate under the CJC-1295 label, and they differ mainly in how long they persist in circulation. The version carrying a drug affinity complex includes a maleimidopropionic acid linker that forms a covalent bond with serum albumin. The other version, usually written as modified GRF(1-29) or tetrasubstituted GRF(1-29), lacks that linker and is cleared quickly. Mixing the two produces inconsistent readings of published half-life values, because the linker rather than the receptor-facing sequence drives most of the difference.
Two principal forms appear in the literature and in research supply. One carries a drug affinity complex, a maleimide-based group that forms a covalent bond with circulating albumin. This linkage slows clearance and produces a long-lasting elevation of peptide levels. The other form lacks that group and is often labeled MOD GRF(1-29). It has a much shorter circulation time. Both variants retain the same core receptor-binding sequence. Reported half-lives differ substantially between the two.
At the pituitary, the peptide binds the growth hormone-releasing hormone receptor on somatotroph cells. Receptor activation raises intracellular cyclic AMP and triggers release of stored growth hormone. Somatostatin and other hypothalamic signals modulate this response. Negative feedback from insulin-like growth factor 1 also influences output. The same regulatory architecture operates with the native hormone. Whether the synthetic analog alters feedback dynamics over repeated exposure remains an open question. Most published receptor work uses cell models rather than intact human systems.
CJC-1295 is a synthetic peptide belonging to the growth hormone-releasing hormone analog family. It comprises twenty-nine amino acid residues derived from the N-terminal region of natural GHRH. The molecule incorporates several non-natural substitutions that increase resistance to enzymatic degradation. These modifications extend its activity compared with the native hormone fragment. Researchers use it to study pituitary growth hormone secretion in laboratory and clinical settings. This compound is distinct from native GHRH in its stability profile.
=== EC 1.14.21 With NADH or NADPH as one donor, and the other dehydrogenated === EC 1.14.21.1: Now EC 1.14.19.64, (S)-stylopine synthase EC 1.14.21.2: Now EC 1.14.19.65, (S)-cheilanthifoline synthase EC 1.14.21.3: Now EC 1.14.19.66, berbamunine synthase EC 1.14.21.4: Now EC 1.14.19.67, salutaridine synthase EC 1.14.21.5: Now EC 1.14.19.68, (S)-canadine synthase EC 1.14.21.6: Now EC 1.14.19.20, Δ7-sterol 5(6)-desaturase EC 1.14.21.7: Now EC 1.14.19.69, biflaviolin synthase EC 1.14.21.8: Now EC 1.14.19.63, pseudobaptigenin synthase EC 1.14.21.9: Now EC 1.14.19.70, mycocyclosin synthase * EC 1.14.21.10: Now EC 1.14.19.71, fumitremorgin C synthase * EC 1.14.21.11: Now EC 1.14.19.72, (–)-pluviatolide synthase * EC 1.14.21.12: Now EC 1.14.19.73, (S)-nandinine synthase *
== History == In 1959, physicist Richard Feynman gave a talk titled "There's Plenty of Room at the Bottom" to the American Physical Society. He imagined a world in which "we could arrange atoms one by one, just as we want them." This idea set the stage for the bottom-up synthesis approach in which constituent components interact to form higher-ordered structures in a controllable manner. The study of self-assembly of nanoparticles began with recognition that some properties of atoms and molecules enable them to arrange themselves into patterns. A variety of applications where the self-assembly of nanoparticles might be useful. For example, building sensors or computer chips. Definition Self-assembly is defined as a process in which individual units of material associate with themselves spontaneously into a defined and organized structure or larger units with minimal external direction. Self-assembly is recognized as a highly useful technique to achieve outstanding qualities in both organic and inorganic nanostructures. According to George M.
Cathelicidin antimicrobial peptide (CAMP) is an antimicrobial peptide encoded in the human by the CAMP gene. The active form is LL-37, a 37 amino acid peptide having sequence [LL-37, 37 aa] In humans, CAMP encodes the peptide precursor CAP-18 (18 kDa), which is processed by proteinase 3-mediated extracellular cleavage into the active form LL-37. The cathelicidin family includes 30 types of which LL-37 is the only cathelicidin in the human. Cathelicidins are stored in the secretory granules of neutrophils and macrophages and can be released following activation by leukocytes. Cathelicidin peptides are dual-natured molecules called amphiphiles: one end of the molecule is attracted to water and repelled by fats and proteins, and the other end is attracted to fat and proteins and repelled by water. Members of this family react to pathogens by disintegrating, damaging, or puncturing cell membranes. Cathelicidins thus serve a critical role in mammalian innate immune defense against invasive bacterial infection. The cathelicidin family of peptides are classified as antimicrobial peptides (AMPs). The AMP family also includes the defensins. Whilst the defensins share common structural features, cathelicidin-related peptides are highly heterogeneous. Members of the cathelicidin family of antimicrobial polypeptides are characterized by a highly conserved region (cathelin domain) and a highly variable cathelicidin peptide domain. Cathelicidin peptides have been isolated from many different species of mammals, including marsupials.
== History == The initial discovery of this family of proteins is attributed to Adler et al. (1967). First identified as E. coli mutants that could not produce a properly localized septum, resulting in the generation of minicells due to mislocalized cell division occurring near the bacterial poles. This caused miniature vesicles to pinch off, void of essential molecular constituents permitting it to exist as a viable bacterial cell. Minicells are achromosomal cells that are products of aberrant cell division, and contain RNA and protein, but little or no chromosomal DNA. This finding led to the identification of three interacting proteins involved in a dynamic system of localizing the mid-zone of the cell for properly controlled cell division.
The first record of tea in English came from a letter written by Richard Wickham, who ran an East India Company office in Japan, writing to a merchant in Macao requesting "the best sort of chaw" in 1615. Peter Mundy, a traveller and merchant who came across tea in Fujian in 1637, wrote, "chaa – only water with a kind of herb boyled in it". Tea was sold in a coffee house in London in 1657, Samuel Pepys tasted tea in 1660, and Catherine of Braganza took the tea-drinking habit to the English court when she married Charles II in 1662. Tea, however, was not widely consumed in the British Isles until the 18th century and remained expensive until the latter part of that period. English drinkers preferred to add sugar and milk to black tea, as the tea of choice in the 1720s. Tea smuggling during the 18th century led to the general public being able to afford and consume tea. The British government removed the tax on tea, thereby eliminating the smuggling trade, by 1785. In Britain and Ireland, tea was initially consumed as a luxury item on special occasions, such as religious festivals, wakes, and domestic work gatherings. The price of tea in Europe fell steadily during the 19th century, especially after Indian tea began to arrive in large quantities; by the late 19th century tea had become an everyday beverage for all levels of society. Consuming tea played a role in historical events – the Tea Act of 1773 provoked the Boston Tea Party that escalated into the American Revolution.
Sources: en.wikipedia.org
Hydrothermal vents are fissures on the seabed from which geothermally heated water discharges. They are commonly found near volcanically active places, areas where tectonic plates are moving apart at mid-ocean ridges, ocean basins, and hotspots. The dispersal of hydrothermal fluids throughout the global ocean at active vent sites creates hydrothermal plumes. Hydrothermal deposits are rocks and mineral ore deposits formed by the action of hydrothermal vents. Hydrothermal vents exist because the Earth is both geologically active and has large amounts of water on its surface and within its crust. Under the sea, they may form features called black smokers or white smokers, which deliver a wide range of elements to the world's oceans, thus contributing to global marine biogeochemistry. Relative to the majority of the deep sea, the areas around hydrothermal vents are biologically more productive, often hosting complex communities fueled by the chemicals dissolved in the vent fluids. Chemosynthetic bacteria and archaea found around hydrothermal vents form the base of the food chain, supporting diverse organisms including giant tube worms, clams, limpets, and shrimp. Active hydrothermal vents are thought to exist on Jupiter's moon Europa and Saturn's moon Enceladus, and it is speculated that ancient hydrothermal vents once existed on Mars. Hydrothermal vents have been hypothesized to have been a significant factor to starting abiogenesis and the survival of primitive life. The conditions of these vents have been shown to support the synthesis of molecules important to life.
For example, γδ T cells express a T-cell receptor comprising γ and δ chains instead of the α and β chains that conventional T cell receptors use, and they are able to recognize antigen without the need for presenting it on MHC proteins (though some have shown the ability to recognize MHC-presented antigens), instead having a mode of recognition that resembles that of antibodies, or recognizing phosphoantigens (antigens that are phosphorylated) through butyrophilin. Mucosa-associated invariant T cells (MAIT) cells recognize ligands presented by the MHC-related protein MR1, which presents metabolites of riboflavin, pyridoxine, and folates. NKT cells recognize glycolipid antigens presented on CD1d, most prominently α-galactosylceramide. In contrast to T cell receptors, antibodies can recognize any type of molecule at virtually any size and can recognize either linear or conformational epitopes (the amino acids that comprise an epitope do not need to be next to each other in the primary structure but do need to be near one another when the protein is folded). At the molecular level, an antigen can be characterized by its ability to bind to an antibody's paratopes. Different antibodies have the potential to discriminate among specific epitopes present on the antigen surface.
Mahathir also strengthened political and economic cooperation with China, whilst maintaining diplomatic ambivalence on security issues to avoid escalating territorial disputes in the South China Sea. He openly criticised China's involvement in Malaysia's communist insurgency, but downplayed any military threat from China after the Cold War ended. In 1985, Mahathir visited China for the first time as prime minister, where he met Chinese leader Deng Xiaoping, establishing a new level of trust that laid the foundation for Malaysia-China relations and set the stage for decades of economic and diplomatic growth. Later, he visited China again in 1993, 1994, 1996, 1999, and twice in 2001. In the early 1990s, Mahathir played a key role in engaging China with ASEAN despite South China Sea disputes, particularly in the post-Tiananmen and post-Cold War contexts, paving the way for then Chinese Foreign Minister Qian Qichen to attend the ASEAN meeting's opening ceremony in July 1991 as a guest of the Malaysian government, and eventually leading to China's upgrade to ASEAN's dialogue partner in 1996. Amidst the Asian financial crisis, Mahathir also led several large delegations to China and Russia to seek regional economic cooperation. Besides that, Mahathir also had significant interactions with Taiwan, especially during the 1980s and 1990s, when economic ties between the two sides were at their strongest despite the lack of formal diplomatic relations.
Since 2023 the European Commission Regulation 2023/915 states that processing contaminants of food though PAHs are not allowed to exceed a sum of 4 PAHs for BaP in order to protect public health. BaP is discharged in wastewater by industries such as smelters, particularly iron and steel mills and aluminium smelters.
genetic code A set of rules by which information encoded within nucleic acids is translated into proteins by living cells. These rules define how sequences of three consecutive nucleotides called codons specify which amino acid will be added next during protein synthesis. The vast majority of living organisms use the same genetic code (sometimes referred to as the "standard" genetic code) but variant codes do exist.
Sources: en.wikipedia.org
Mass spectrometry establishes whether the observed molecular weight matches the calculated sequence mass. Chromatographic retention and fragment mapping add further confidence about sequence and composition. A single technique alone is rarely treated as sufficient evidence of identity.
Dry powder is markedly more stable than solution and is usually held frozen and desiccated. Room temperature exposure over days degrades it more slowly than most people assume, but long-term integrity favors freezer storage. Light protection is recommended regardless of temperature.
Methods, columns, gradients, and detection wavelengths are not standardized across laboratories. Some figures describe only the main peak area at one wavelength and ignore water, salts, or counter-ions. Without stated conditions, comparing reported percentages across sources is unreliable.
The names are often used interchangeably in casual writing, but they are not strictly identical. Modified GRF(1-29) refers to the unconjugated analogue carrying only the four substitutions. The version sold as CJC-1295 with DAC includes the albumin binding linker and clears much more slowly.